A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10113
Swiss-prot Accession number	Q6BEG6 (Sequence in FASTA format)
Description	Appetite-regulating hormone precursor (Growth hormone secretagogue)(Growth hormone-releasing peptide) (Motilin-related peptide)[Contains: Ghrelin; Obestatin].
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the motilin family.
Tissue Specificity	N/A
Post translational modification	O-n-octanoylation is essential for ghrelin activity (By similarity). Amidation of Leu-98 is essential for obestatin activity (By similarity).
Function	Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation
Protein Length	117 Amino acids
Molecular weight	12956
References	1   Lin X., Miyazato M., Kaiya H., Ida T., Kangawa K.; "cDNA cloning of feline and caprine ghrelin."; Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases.
Domain Name	Motilin_assoc  Motilin_ghrelin
Hormone Name	Ghrelin
Mature Hormone Sequence	GSSFLSPEHQKVQQRKESKKPPAKLQPR
Position of mature hormone in Pre-Hormone protein	28 Residues from position (24-51)
Receptor	N/A
Gene ID	493844
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10114
Swiss-prot Accession number	Q6BEG6 (Sequence in FASTA format)
Description	Appetite-regulating hormone precursor (Growth hormone secretagogue)(Growth hormone-releasing peptide) (Motilin-related peptide)[Contains: Ghrelin; Obestatin].
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the motilin family.
Tissue Specificity	N/A
Post translational modification	O-n-octanoylation is essential for ghrelin activity (By similarity). Amidation of Leu-98 is essential for obestatin activity (By similarity).
Function	Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility.
Protein Length	117 Amino acids
Molecular weight	12956
References	1   Lin X., Miyazato M., Kaiya H., Ida T., Kangawa K.; "cDNA cloning of feline and caprine ghrelin."; Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases.
Domain Name	Motilin_assoc  Motilin_ghrelin
Hormone Name	Obestatin
Mature Hormone Sequence	FNAPFDVGIKLSGAQYHQHGQAL
Position of mature hormone in Pre-Hormone protein	23 Residues from position (76-98)
Receptor	N/A
Gene ID	493844
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10292
Swiss-prot Accession number	Q9MYK8 (Sequence in FASTA format)
Description	Prorelaxin precursor (RXN) [Contains: Relaxin B chain; Relaxin Achain].
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	Expressed by the placenta. Exclusively detected in cells located in the lamellar placental labyrinth and absent from other placental and nonplacental uterine parts
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	180 Amino acids
Molecular weight	20360
References	1  PubMed abstract 9915995
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	QEEVLKACGREFVRLQIRICGSLSWG
Position of mature hormone in Pre-Hormone protein	26 Residues from position (26-51)
Receptor	N/A
Gene ID	493883
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10293
Swiss-prot Accession number	Q9MYK8 (Sequence in FASTA format)
Description	Prorelaxin precursor (RXN) [Contains: Relaxin B chain; Relaxin Achain].
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	Expressed by the placenta. Exclusively detected in cells located in the lamellar placental labyrinth and absent from other placental and nonplacental uterine parts
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	180 Amino acids
Molecular weight	20360
References	1  PubMed abstract 9915995
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	SDYIRYSDRCCNVGCTRKELADLC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (157-180)
Receptor	N/A
Gene ID	493883
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10325
Swiss-prot Accession number	Q52R90 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism
Protein Length	138 Amino acids
Molecular weight	15483
References	1  PubMed abstract 16122898
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	FCFPTEYMMHVERKECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFLYKTVEIPGCPHHVTPYFSYPVAVSCKCGKCNTDYSDCIHEAIKTNDCTKPQKSD
Position of mature hormone in Pre-Hormone protein	112 Residues from position (21-132)
Receptor	Q9BGN4    Detail in HMRbase
Gene ID	554350
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 6

HMRbase accession number	10415
Swiss-prot Accession number	P06884 (Sequence in FASTA format)
Description	Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; Pancreatic icosapeptide] (Fragment).
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	66 Amino acids
Molecular weight	7483
References	1  PubMed abstract 3827854
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APLEPVYPGDNATPEQMAQYAAELRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10638
Swiss-prot Accession number	O77805 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	143 Amino acids
Molecular weight	15318
References	1   Pukazhenthi B.S., Varma G.M., Brown J.L.; "Molecular cloning and sequence analysis of the cDNA for the felineluteinizing hormone beta subunit."; Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SREPLRPLCRPINATLAAENEACPVCVTFTTTICAGYCPSMMRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPVVSFPVALSCRCGPCRLSSSDCGGPRAQPLACDRPPLPGLLFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (23-143)
Receptor	N/A
Gene ID	493833
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	10680
Swiss-prot Accession number	P06884 (Sequence in FASTA format)
Description	Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; Pancreatic icosapeptide] (Fragment).
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	The physiological role for the icosapeptide has not yet been elucidated
Protein Length	66 Amino acids
Molecular weight	7483
References	1  PubMed abstract 3827854
Domain Name	Hormone_3
Hormone Name	Pancreatic icosapeptide
Mature Hormone Sequence	DRGETLDILEWGSPHAAAPR
Position of mature hormone in Pre-Hormone protein	20 Residues from position (40-59)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	10705
Swiss-prot Accession number	Q9GL67 (Sequence in FASTA format)
Description	Parathyroid hormone precursor (Parathyrin) (PTH).
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the parathyroid hormone family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion
Protein Length	115 Amino acids
Molecular weight	12921
References	1   Toribio R.E., Kohn C.W., Leone G.W., Capen C.C., Rosol T.J.; "Molecular cloning of feline preproparathyroid hormone."; Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases.
Domain Name	Parathyroid
Hormone Name	Parathyroid hormone (Parathyrin) (PTH)
Mature Hormone Sequence	SVSEIQFMHNLGKHLSSVERVEWLRRKLQDVHNFVALGAPIAHRDGGSQRPRKKEDNVPAENHQKSLGEADKADVDVLIKAKSQ
Position of mature hormone in Pre-Hormone protein	84 Residues from position (32-115)
Receptor	N/A
Gene ID	493684
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	10737
Swiss-prot Accession number	P46404 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues
Protein Length	216 Amino acids
Molecular weight	24454
References	1  PubMed abstract 8654953 2  PubMed abstract 7642118
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRGGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
Position of mature hormone in Pre-Hormone protein	190 Residues from position (27-216)
Receptor	N/A
Gene ID	493931
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	10836
Swiss-prot Accession number	P06306 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12069
References	1   Okamoto S., Morimatsu M.; "Cat insulin."; Submitted (MAY-2000) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 3518635
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	493804
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	10837
Swiss-prot Accession number	P06306 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12069
References	1   Okamoto S., Morimatsu M.; "Cat insulin."; Submitted (MAY-2000) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 3518635
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCASVCSLYQLEHYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	N/A
Gene ID	493804
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	11013
Swiss-prot Accession number	P46403 (Sequence in FASTA format)
Description	Prolactin precursor (PRL).
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Prolactin acts primarily on the mammary gland by promoting lactation
Protein Length	229 Amino acids
Molecular weight	26282
References	1  PubMed abstract 8654953
Domain Name	Hormone_1
Hormone Name	Prolactin
Mature Hormone Sequence	LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLPTPEDKEQAQQIHHEDLLNVILRVLRSWNDPLYHLVTEVRGLHEAPDAILSRAIEIEEQNRRLLEGMEKIVHQVHPGVRENEVYSVWSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDSYLKLLKCRIVYDSNC
Position of mature hormone in Pre-Hormone protein	199 Residues from position (31-229)
Receptor	N/A
Gene ID	751517
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 14

HMRbase accession number	11148
Swiss-prot Accession number	P01354 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin].
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	104 Amino acids
Molecular weight	11482
References	1  PubMed abstract 1773057 2  PubMed abstract 5784957
Domain Name	Gastrin
Hormone Name	Big gastrin
Mature Hormone Sequence	QLGLQGPPQQVADLSKKQGPWLEEEEAAYGWMDF
Position of mature hormone in Pre-Hormone protein	34 Residues from position (59-92)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 15

HMRbase accession number	11149
Swiss-prot Accession number	P01354 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin].
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	104 Amino acids
Molecular weight	11482
References	1  PubMed abstract 1773057 2  PubMed abstract 5784957
Domain Name	Gastrin
Hormone Name	Gastrin
Mature Hormone Sequence	QGPWLEEEEAAYGWMDF
Position of mature hormone in Pre-Hormone protein	17 Residues from position (76-92)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 16

HMRbase accession number	11502
Swiss-prot Accession number	Q52R91 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha).
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	120 Amino acids
Molecular weight	13513
References	1  PubMed abstract 16122898 2  PubMed abstract 16122898
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYHHKI
Position of mature hormone in Pre-Hormone protein	96 Residues from position (25-120)
Receptor	Q5GJ04   Detail in HMRbase    Q9BGN4    Detail in HMRbase
Gene ID	751819
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 17

HMRbase accession number	11527
Swiss-prot Accession number	Q9N2C1 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass (By similarity).
Protein Length	167 Amino acids
Molecular weight	18584
References	----
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	493838
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated